|  Help  |  About  |  Contact Us

Sequence :

Length  128 Residues  MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV
MD5 Checksum  3701d01a00f7fc73bcf6692a4f8e67e2