|  Help  |  About  |  Contact Us

Sequence :

Length  48 Residues  MVITSGNDEDRGGQEKESKEESVLAMLGIIGTILNLIVIIFVYIYTTL
MD5 Checksum  62efcc8e7e5b3c6586dca3216a262cc6