|  Help  |  About  |  Contact Us

Sequence :

Length  54 Residues  XRFYWKEFVNEVDVLVFMVDSTDRLRLPWARQELQKLLDRDPDLPVVIVANKQM
MD5 Checksum  8d9598c1a42d6ea52d4a8d7a4734968d